2025-12-17 REL RCSB INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY EXPERIMENTAL_SUMMARY citation em_admin _citation.journal_volume _citation.page_first _citation.page_last _em_admin.last_update DATABASE_REFERENCES citation em_admin _citation.pdbx_database_id_PubMed _citation.title _em_admin.last_update DATABASE_REFERENCES citation em_admin _citation.journal_volume _citation.page_first _citation.page_last _em_admin.last_update RCSB RCSB 2024-08-08 2025-08-13 2025-08-13 2025-12-17 National Institutes of Health/Eunice Kennedy Shriver National Institute of Child Health & Human Development (NIH/NICHD) 1DP2HL163810-01 United States American Heart Association 847236 United States Cryo-EM structure of amyloid fibril extracted from liver of a variant ATTR T60A amyloidosis patient 3 Nguyen AB Fernandez-Ramirez MC Saelices L Transthyretin, Amyloidosis, ATTR, liver, PROTEIN FIBRIL Fernandez-Ramirez MDC Nguyen BA Afrin S Singh V Evers B Shelton JM Escobar CL Bassett P Wang L Pekala M Ahmed Y Cabrera Hernandez LO Pedretti R Singh P Canepa J Wosztyl A Li Y Boyer DR Cao Q Saelices L Structural and molecular homogeneity of ATTRv-T60A amyloid fibrils across patients and organs. Structure UK 33 2013 2019.e4 2025 41106377 doi:10.1016/j.str.2025.09.008 0969-2126 2005 STRUE6 EMD-46479 other EM volume EMD-46481 other EM volume EMD-46482 other EM volume EMD-46487 other EM volume 9d2g FULLOVERLAP EMDB EMD-46479 other EM volume EMDB EMD-46481 other EM volume EMDB EMD-46482 other EM volume EMDB EMD-46487 other EM volume EMDB EMD-46495 associated EM volume
Cryo-EM structure of amyloid fibril extracted from liver of a variant ATTR T60A amyloidosis patient 3
 PDB 9D21 unspecified PDB 9D23 unspecified PDB 9D24 unspecified PDB 9D27 unspecified Amyloid fibril from liver of a variant ATTR T60A amyloidosis patient Amyloid fibril from liver of a variant ATTR T60A amyloidosis patient 0 1 Homo sapiens liver liver Transthyretin Homo sapiens Liver Liver 0.013747334 5 LEVO GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTAEEEFVEGIYKVEIDTKSYWK ALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE P02766 helical helicalArray 7.0
We used water as the buffer for the final elution of fibrils
 Quantifoil R1.2/1.3 COPPER 300 CARBON HOLEY GLOW DISCHARGE ETHANE 100 295.15 FEI VITROBOT MARK IV FEI TITAN KRIOS FLOOD BEAM BRIGHT FIELD FIELD EMISSION GUN 300 2.7 1.2 2.8000000000000003 FEI FALCON IV (4k x 4k) 1 6691 5.93 40.0 1 1 4.91 -1.25 C1 3.1 FSC 0.143 CUT-OFF RELION 4.0 30791 RELION 4.0 CTFFIND-4.1 NONE 727422 Topaz
particle boxsize of 256 px
Featureless cylinder
 NOT APPLICABLE RELION 4.0 emd_46495.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 256 256 256 0 0 0 256 256 256 242.176 242.176 242.176 90.0 90.0 90.0 X Y Z -0.1636912 0.23105586 0.00026894954 0.0067738676 0.946 0.946 0.946 0.065 AUTHOR was used for model-building 9d24 A PDB experimental model RIGID BODY FIT REAL emd_46495_msk_1.map emd_46495_additional_1.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 256 256 256 0 0 0 256 256 256 242.176 242.176 242.176 90.0 90.0 90.0 X Y Z -0.03696169 0.07713453 0.000677581 0.005363225 0.946 0.946 0.946 AUTHOR combined map from two half-maps emd_46495_half_map_1.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 256 256 256 0 0 0 256 256 256 242.176 242.176 242.176 90.0 90.0 90.0 X Y Z -0.04091583 0.08344845 0.00067613355 0.005690875 0.946 0.946 0.946 AUTHOR half-map 02 emd_46495_half_map_2.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 256 256 256 0 0 0 256 256 256 242.176 242.176 242.176 90.0 90.0 90.0 X Y Z -0.045960553 0.08175042 0.0006789058 0.005679911 0.946 0.946 0.946 AUTHOR half-map 01