2026-01-21 REL RCSB INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY RCSB RCSB 2024-10-11 2026-01-21 2026-01-21 2026-01-21 National Science Foundation (NSF, United States) United States attPmm bound serine integrase complex in the tetrameric state Shin H Rice PA Olorunniji FJ Viral protein, Integrase, Recombinase, Complex, Recombination Directionality Factor, Integration, Excision, DNA BINDING PROTEIN Shin HS Rice PA Structural Basis of Directionality Control in Large Serine Integrases To Be Published 0353 EMD-47287 other EM volume
cleaved attPmm bound serine integrase and RDF complex in the dimeric state
 EMD-47286 other EM volume
attLmm bound serine integrase and RDF complex in the post-rotation state
 EMD-47284 other EM volume
attLmm bound serine integrase and RDF complex in the pre-rotation state
 EMD-72632 other EM volume
uncleaved attPsym bound serine integrase and RDF omplex in the dimeric state
 EMD-72552 other EM volume
attLsym bound serine integrase complex in the dimeric state
 EMD-47289 other EM volume
attPmm and attBmm bound serine integrase complex in the post-rotation state
 EMD-47288 other EM volume
attPmm and attBmm bound serine integrase complex in the pre-rotation state
 9dxk FULLOVERLAP EMDB EMD-47290 associated EM volume
attPmm bound serine integrase complex in the tetrameric state
 EMDB EMD-47287 other EM volume
cleaved attPmm bound serine integrase and RDF complex in the dimeric state
 EMDB EMD-47286 other EM volume
attLmm bound serine integrase and RDF complex in the post-rotation state
 EMDB EMD-47284 other EM volume
attLmm bound serine integrase and RDF complex in the pre-rotation state
 EMDB EMD-72632 other EM volume
uncleaved attPsym bound serine integrase and RDF omplex in the dimeric state
 EMDB EMD-72552 other EM volume
attLsym bound serine integrase complex in the dimeric state
 EMDB EMD-47289 other EM volume
attPmm and attBmm bound serine integrase complex in the post-rotation state
 EMDB EMD-47288 other EM volume
attPmm and attBmm bound serine integrase complex in the pre-rotation state
 attLmm bound serine integrase and RDF complex in the pre-rotation state attLmm bound serine integrase and RDF complex in the pre-rotation state 0 1 2 3 Bacillus subtilis Resolvase homolog YokA Bacillus subtilis 0.06323206599999999 4 Escherichia coli 'BL21-Gold(DE3)pLysS AG' LEVO MELKNIVNSYNITNILGYLRRSRQDMEREKRTGEDTLTEQKELMNKILTAIEIPYELKMEIGSGESIDGRPVFKECLKDL EEGKYQAIAVKEITRLSRGSYSDAGQIVNLLQSKRLIIITPYKVYDPRNPVDMRQIRFELFMAREEFEMTRERMTGAKYT YAAQGKWISGLAPYGYQLNKKTSKLDPVEDEAKVVQLIFNIFLNGLNGKDYSYTAIASHLTNLQIPTPSGKKRWNQYTIK AILQNEVYIGTVKYKVREKTKDGKRTIRPEKEQIVVQDAHAPIIDKEQFQQSQVKIANKVPLLPNKDEFELSELAGVCTC SKCGEPLSKYESKRIRKNKDGTESVYHVKSLTCKKNKCTYVRYNDVENAILDYLSSLNDLNDSTLTKHINSMLSKYEDDN SNMKTKKQMSEHLSQKEKELKNKENFIFDKYESGIYSDELFLKRKAALDEEFKELQNAKNELNGLQDTQSEIDSNTVRNN INKIIDQYHIESSSEKKNELLRMVLKDVIVNMTQKRKGPIPAQFEITPILRFNFIFDLTATNSFH O32006 DNA (34-MER) Bacillus subtilis 0.010433742 4 (DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DG)(DT)(DA)(DG)(DT)(DA)(DA)(DG)(DT)(DA)(DT)(DC) (DT)(DT)(DA)(DA)(DT)(DA)(DT)(DA)(DC)(DA)(DG)(DC)(DT)(DT) DNA DNA (33-MER) Bacillus subtilis 0.010161636 4 (DA)(DG)(DC)(DT)(DG)(DT)(DA)(DT)(DA)(DT)(DT)(DA)(DA)(DG)(DA)(DT)(DA)(DC)(DT)(DT) (DA)(DC)(DT)(DA)(DC)(DA)(DA)(DA)(DA)(DA)(DA)(DA)(DA) DNA ZINC ION 6.5409e-05 4 ZN singleParticle particle 8.0 vitreous ice ETHANE 100 291.15 FEI VITROBOT MARK IV TFS KRIOS FLOOD BEAM BRIGHT FIELD FIELD EMISSION GUN 300 2.7 1.0 2.5 GATAN K3 (6k x 4k) 65.0 1 PHASE FLIPPING ONLY 4.81 FSC 0.143 CUT-OFF cryoSPARC 92812 RANDOM ASSIGNMENT MAXIMUM LIKELIHOOD emd_47290.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 320 320 320 0 0 0 320 320 320 340.80002 340.80002 340.80002 90.0 90.0 90.0 X Y Z -0.17569396 0.48113942 0.0009921911 0.015786512 1.065 1.065 1.065 0.04 AUTHOR consensus map sharpened emd_47290_msk_1.map emd_47290_additional_1.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 320 320 320 0 0 0 320 320 320 340.80002 340.80002 340.80002 90.0 90.0 90.0 X Y Z -0.05683727 0.32479605 0.000992191 0.013896892 1.065 1.065 1.065 AUTHOR consensus map (raw) emd_47290_half_map_2.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 320 320 320 0 0 0 320 320 320 340.80002 340.80002 340.80002 90.0 90.0 90.0 X Y Z -0.1148575 0.39520893 0.0009971692 0.01897365 1.065 1.065 1.065 AUTHOR consensus map (half A) emd_47290_half_map_1.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 320 320 320 0 0 0 320 320 320 340.80002 340.80002 340.80002 90.0 90.0 90.0 X Y Z -0.13215134 0.3859939 0.0009912166 0.018937651 1.065 1.065 1.065 AUTHOR consensus map (half B)