<?xml version="1.0" encoding="UTF-8"?>
<emd xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:noNamespaceSchemaLocation="https://ftp.ebi.ac.uk/pub/databases/em_ebi/emdb_related/emdb-schemas/emdb_schemas/v3/v3_0_11_0/emdb.xsd" version="3.0.11.0" emdb_id="EMD-52601">
    <admin>
        <current_status>
            <date>2026-04-01</date>
            <code>REL</code>
            <processing_site>PDBe</processing_site>
        </current_status>
        <revision_history>
            <revision version="1.0" date="2025-12-17">
                <change_list>
                    <model>
                        <revision_type>INITIAL_RELEASE</revision_type>
                        <provider>REPOSITORY</provider>
                    </model>
                    <metadata>
                        <revision_type>INITIAL_RELEASE</revision_type>
                        <provider>REPOSITORY</provider>
                    </metadata>
                    <additional_map part="1">
                        <revision_type>INITIAL_RELEASE</revision_type>
                        <provider>REPOSITORY</provider>
                    </additional_map>
                    <additional_map part="2">
                        <revision_type>INITIAL_RELEASE</revision_type>
                        <provider>REPOSITORY</provider>
                    </additional_map>
                    <fsc>
                        <revision_type>INITIAL_RELEASE</revision_type>
                        <provider>REPOSITORY</provider>
                    </fsc>
                    <half_map part="1">
                        <revision_type>INITIAL_RELEASE</revision_type>
                        <provider>REPOSITORY</provider>
                    </half_map>
                    <half_map part="2">
                        <revision_type>INITIAL_RELEASE</revision_type>
                        <provider>REPOSITORY</provider>
                    </half_map>
                    <image>
                        <revision_type>INITIAL_RELEASE</revision_type>
                        <provider>REPOSITORY</provider>
                    </image>
                    <mask part="1">
                        <revision_type>INITIAL_RELEASE</revision_type>
                        <provider>REPOSITORY</provider>
                    </mask>
                    <primary_map>
                        <revision_type>INITIAL_RELEASE</revision_type>
                        <provider>REPOSITORY</provider>
                    </primary_map>
                </change_list>
            </revision>
            <revision version="1.1" date="2026-02-18">
                <change_list>
                    <model>
                        <revision_group>DATABASE_REFERENCES</revision_group>
                        <categories>
                            <category>citation</category>
                            <category>citation_author</category>
                            <category>em_admin</category>
                        </categories>
                        <items>
                            <item>_citation.country</item>
                            <item>_citation.journal_abbrev</item>
                            <item>_citation.journal_id_CSD</item>
                            <item>_citation.journal_id_ISSN</item>
                            <item>_citation.pdbx_database_id_DOI</item>
                            <item>_citation.pdbx_database_id_PubMed</item>
                            <item>_citation.title</item>
                            <item>_citation.year</item>
                            <item>_citation_author.identifier_ORCID</item>
                            <item>_em_admin.last_update</item>
                        </items>
                    </model>
                    <metadata>
                        <revision_group>EXPERIMENTAL_SUMMARY</revision_group>
                        <categories>
                            <category>citation</category>
                            <category>citation_author</category>
                            <category>em_admin</category>
                        </categories>
                        <items>
                            <item>_citation.country</item>
                            <item>_citation.journal_abbrev</item>
                            <item>_citation.journal_id_CSD</item>
                            <item>_citation.journal_id_ISSN</item>
                            <item>_citation.pdbx_database_id_DOI</item>
                            <item>_citation.pdbx_database_id_PubMed</item>
                            <item>_citation.title</item>
                            <item>_citation.year</item>
                            <item>_citation_author.identifier_ORCID</item>
                            <item>_em_admin.last_update</item>
                        </items>
                    </metadata>
                </change_list>
            </revision>
            <revision version="1.2" date="2026-04-01">
                <change_list>
                    <model>
                        <revision_group>DATABASE_REFERENCES</revision_group>
                        <categories>
                            <category>citation</category>
                            <category>citation_author</category>
                            <category>em_admin</category>
                        </categories>
                        <items>
                            <item>_citation.journal_volume</item>
                            <item>_citation_author.identifier_ORCID</item>
                            <item>_em_admin.last_update</item>
                        </items>
                    </model>
                    <metadata>
                        <revision_group>EXPERIMENTAL_SUMMARY</revision_group>
                        <categories>
                            <category>citation</category>
                            <category>citation_author</category>
                            <category>em_admin</category>
                        </categories>
                        <items>
                            <item>_citation.journal_volume</item>
                            <item>_citation_author.identifier_ORCID</item>
                            <item>_em_admin.last_update</item>
                        </items>
                    </metadata>
                </change_list>
            </revision>
        </revision_history>
        <sites>
            <deposition>PDBe</deposition>
            <last_processing>PDBe</last_processing>
        </sites>
        <key_dates>
            <deposition>2025-01-23</deposition>
            <header_release>2025-12-17</header_release>
            <map_release>2025-12-17</map_release>
            <update>2026-04-01</update>
        </key_dates>
        <grant_support>
            <grant_reference>
                <funding_body>Academy of Finland</funding_body>
                <code>321762</code>
                <country>Finland</country>
            </grant_reference>
            <grant_reference>
                <funding_body>Academy of Finland</funding_body>
                <code>360760</code>
                <country>Finland</country>
            </grant_reference>
            <grant_reference>
                <funding_body>Sigrid Juselius Foundation</funding_body>
                <code>2023</code>
                <country>Finland</country>
            </grant_reference>
        </grant_support>
        <title>Csu pilus rod type 1 stack</title>
        <authors_list>
            <author>Malmi H</author>
            <author>Pakharukova N</author>
            <author>Zavialov AV</author>
        </authors_list>
        <keywords>pili, fimbriae, Acinetobacter baumannii pili, chaperone-usher pathway, archaic chaperone-usher pili, biofilm, 3D biofilm, adhesion, pathogenesis, pilus antiparallel binding junction, CELL ADHESION</keywords>
    </admin>
    <crossreferences>
        <citation_list>
            <primary_citation>
                <journal_citation published="true">
                    <author order="1">Malmi H</author>
                    <author order="2">Pakharukova N</author>
                    <author order="3">Paul B</author>
                    <author order="4">Tuittila M</author>
                    <author order="5">Ahmad I</author>
                    <author order="6">Knight SD</author>
                    <author order="7">Uhlin BE</author>
                    <author order="8">Ghosal D</author>
                    <author order="9">Zavialov AV</author>
                    <title>Antiparallel stacking of Csu pili drives Acinetobacter baumannii 3D biofilm assembly.</title>
                    <journal_abbreviation>Nat Commun</journal_abbreviation>
                    <country>UK</country>
                    <volume>17</volume>
                    <year>2026</year>
                    <external_references type="PUBMED">41654547</external_references>
                    <external_references type="DOI">doi:10.1038/s41467-026-68860-z</external_references>
                    <external_references type="ISSN">2041-1723</external_references>
                </journal_citation>
            </primary_citation>
        </citation_list>
        <pdb_list>
            <pdb_reference>
                <pdb_id>9i3n</pdb_id>
                <relationship>
                    <in_frame>FULLOVERLAP</in_frame>
                </relationship>
            </pdb_reference>
        </pdb_list>
        <other_db_list>
            <db_reference>
                <db_name>PDB</db_name>
                <accession_id>7ZL4</accession_id>
                <content_type>unspecified</content_type>
                <details>The earlier structure depicts a single pilus rod, whereas the new structure depicts three pilus rods forming a stack.</details>
            </db_reference>
            <db_reference>
                <db_name>PDB</db_name>
                <accession_id>9I37</accession_id>
                <content_type>unspecified</content_type>
                <details>The other structure depicts a single pilus rod extracted from Acinetobacter baumannii, whereas this structure depicts three pilus rods forming a stack.</details>
            </db_reference>
            <db_reference>
                <db_name>EMDB</db_name>
                <accession_id>EMD-52601</accession_id>
                <content_type>associated EM volume</content_type>
                <details>Csu pilus rod type 1 stack</details>
            </db_reference>
        </other_db_list>
    </crossreferences>
    <sample>
        <name>Csu pilus rod type 1 stack</name>
        <supramolecule_list>
            <complex_supramolecule supramolecule_id="1">
                <name>Csu pilus rod type 1 stack</name>
                <parent>0</parent>
                <macromolecule_list>
                    <macromolecule>
                        <macromolecule_id>1</macromolecule_id>
                    </macromolecule>
                </macromolecule_list>
                <details>Csu pilus rods are homopolymers of subunit CsuA/B. The sample contains Csu pilus rods self-assembled into type 1 and type 2 stack architectures through antiparallel interactions. The stacks accumulate slowly over time as a gel-like substance at the bottom of a sample tube containing purified Csu pili.</details>
                <natural_source database="NCBI">
                    <organism ncbi="470">Acinetobacter baumannii</organism>
                    <strain>19096</strain>
                    <tissue>Planktonic bacteria</tissue>
                    <organelle>Outer membrane</organelle>
                    <cellular_location>Outer membrane</cellular_location>
                </natural_source>
                <molecular_weight>
                    <theoretical units="kDa/nm">16.05974</theoretical>
                </molecular_weight>
            </complex_supramolecule>
        </supramolecule_list>
        <macromolecule_list>
            <protein_or_peptide macromolecule_id="1">
                <name>CsuA/B</name>
                <natural_source database="NCBI">
                    <organism ncbi="470">Acinetobacter baumannii</organism>
                    <strain>19096</strain>
                </natural_source>
                <molecular_weight>
                    <theoretical units="MDa">0.016069642</theoretical>
                </molecular_weight>
                <details>Csu pilus rods are homopolymers of subunit CsuA/B. Structure depicts three Csu pilus rods forming type 1 stack architecture through antiparallel interactions.</details>
                <number_of_copies>57</number_of_copies>
                <recombinant_expression database="NCBI">
                    <recombinant_organism ncbi="511693">Escherichia coli BL21</recombinant_organism>
                </recombinant_expression>
                <enantiomer>LEVO</enantiomer>
                <sequence>
                    <string>AVTGQVDVKLNISTGCTVGGSQTEGNMNKFGTLNFGKTSGTWNNVLTAEVASAATGGNISVTCDGTDPVDFTVAIDGGER
TDRTLKNTASADVVAYNVYRDAARTNLYVVNQPQQFTTVSGQATAVPIFGAIAPNTGTPKAQGDYKDTLLVTVNF</string>
                    <external_references type="UNIPROTKB">A0A6F8TDQ5</external_references>
                </sequence>
            </protein_or_peptide>
        </macromolecule_list>
    </sample>
    <structure_determination_list>
        <structure_determination structure_determination_id="1">
            <method>singleParticle</method>
            <aggregation_state>twoDArray</aggregation_state>
            <specimen_preparation_list>
                <single_particle_preparation preparation_id="1">
                    <buffer>
                        <ph>7.4</ph>
                        <component>
                            <concentration units="mM">20.0</concentration>
                            <formula>C8H18N2O4S</formula>
                            <name>HEPES</name>
                        </component>
                        <component>
                            <concentration units="mM">170.0</concentration>
                            <formula>NaCl</formula>
                            <name>sodium chloride</name>
                        </component>
                        <details>Sample is a fraction taken from an ion exchange column elution gradient, so the NaCl concentration may vary.</details>
                    </buffer>
                    <grid>
                        <model>Quantifoil R1.2/1.3</model>
                        <material>COPPER</material>
                        <mesh>300</mesh>
                        <support_film film_type_id="1">
                            <film_material>CARBON</film_material>
                            <film_topology>HOLEY</film_topology>
                            <film_thickness>20.0</film_thickness>
                        </support_film>
                        <pretreatment>
                            <type>GLOW DISCHARGE</type>
                            <time units="s">20</time>
                            <atmosphere>AIR</atmosphere>
                            <pressure units="kPa">0.014</pressure>
                        </pretreatment>
                    </grid>
                    <vitrification>
                        <cryogen_name>ETHANE</cryogen_name>
                        <chamber_humidity units="percentage">100</chamber_humidity>
                        <chamber_temperature units="K">277.15</chamber_temperature>
                        <instrument>FEI VITROBOT MARK IV</instrument>
                    </vitrification>
                    <details>Csu pilus rods are homopolymers of subunit CsuA/B. The sample contains Csu pilus rods self-assembled into type 1 and type 2 stack architectures through antiparallel interactions. The stacks accumulate slowly over time as a gel-like substance at the bottom of a sample tube containing purified Csu pili.</details>
                </single_particle_preparation>
            </specimen_preparation_list>
            <microscopy_list>
                <single_particle_microscopy microscopy_id="1">
                    <microscope>TFS KRIOS</microscope>
                    <illumination_mode>FLOOD BEAM</illumination_mode>
                    <imaging_mode>BRIGHT FIELD</imaging_mode>
                    <electron_source>FIELD EMISSION GUN</electron_source>
                    <acceleration_voltage units="kV">300</acceleration_voltage>
                    <c2_aperture_diameter units="µm">50.0</c2_aperture_diameter>
                    <nominal_cs units="mm">2.7</nominal_cs>
                    <nominal_defocus_min units="µm">0.4</nominal_defocus_min>
                    <nominal_defocus_max units="µm">1.6</nominal_defocus_max>
                    <nominal_magnification>105000.0</nominal_magnification>
                    <specimen_holder_model>FEI TITAN KRIOS AUTOGRID HOLDER</specimen_holder_model>
                    <cooling_holder_cryogen>NITROGEN</cooling_holder_cryogen>
                    <image_recording_list>
                        <image_recording image_recording_id="1">
                            <film_or_detector_model>GATAN K3 BIOQUANTUM (6k x 4k)</film_or_detector_model>
                            <digitization_details>
                                <dimensions>
                                    <width units="pixel">5760</width>
                                    <height units="pixel">4092</height>
                                </dimensions>
                            </digitization_details>
                            <number_grids_imaged>1</number_grids_imaged>
                            <number_real_images>7941</number_real_images>
                            <average_exposure_time units="s">2.79</average_exposure_time>
                            <average_electron_dose_per_image units="e/Å^2">59.848</average_electron_dose_per_image>
                            <details>Grid squares and holes were selected manually as the pilus stacks were visible in the atlas.</details>
                        </image_recording>
                    </image_recording_list>
                </single_particle_microscopy>
            </microscopy_list>
            <singleparticle_processing image_processing_id="1">
                <image_recording_id>1</image_recording_id>
                <particle_selection>
                    <number_selected>30605819</number_selected>
                    <details>Two different types of Csu pilus stack architectures were solved from the same particle set. Particle picking failed to distinguish between the two, so the initial number of particles is the same for both stack architectures.</details>
                </particle_selection>
                <ctf_correction>
                    <software_list>
                        <software>
                            <name>cryoSPARC</name>
                            <version>v4.5.3</version>
                            <processing_details>Patch CTF Correction</processing_details>
                        </software>
                    </software_list>
                    <type>PHASE FLIPPING AND AMPLITUDE CORRECTION</type>
                </ctf_correction>
                <startup_model type_of_model="OTHER">
                    <details>We used an earlier, unpublished 8.5 A map of Csu pilus type 1 stack as the starting model. It had been generated using Ab Initio reconstruction and another dataset.</details>
                </startup_model>
                <final_reconstruction>
                    <resolution units="Å" res_type="BY AUTHOR">7.58</resolution>
                    <resolution_method>FSC 0.143 CUT-OFF</resolution_method>
                    <software_list>
                        <software>
                            <name>cryoSPARC</name>
                            <version>v4.5.3</version>
                            <processing_details>Local Refinement</processing_details>
                        </software>
                    </software_list>
                    <details>Local Refinement allowed generating a single map without individual particles flipping and settling into pseudosymmetric orientations.</details>
                    <number_images_used>504940</number_images_used>
                </final_reconstruction>
                <initial_angle_assignment>
                    <type>MAXIMUM LIKELIHOOD</type>
                    <software_list>
                        <software>
                            <name>cryoSPARC</name>
                            <version>v4.5.3</version>
                            <processing_details>Homogeneous Refinement and Heterogeneous Refinement</processing_details>
                        </software>
                    </software_list>
                    <details>Homogeneous Refinement indicated that there are two types of stacks in the dataset. Generated masks based on an initial model overlapped with a 2D class allowed splitting the dataset between the two stack architectures.</details>
                </initial_angle_assignment>
                <final_angle_assignment>
                    <type>MAXIMUM LIKELIHOOD</type>
                    <software_list>
                        <software>
                            <name>cryoSPARC</name>
                            <version>v4.5.3</version>
                        </software>
                    </software_list>
                </final_angle_assignment>
                <final_three_d_classification>
                    <number_classes>8</number_classes>
                    <software_list>
                        <software>
                            <name>cryoSPARC</name>
                            <version>v4.5.3</version>
                            <processing_details>Heterogeneous Refinement</processing_details>
                        </software>
                    </software_list>
                    <details>The particles were too big for 3D Classification job, and the particles with Csu pilus stacks had a tendency to flip 180 degrees during refinement due to pseudosymmetries. We used models flipped 180 degrees in every direction as classes to collect the flipped particles and reorient them for local refinement. With the original model, six flipped models and one waste class, we had eight classes.</details>
                </final_three_d_classification>
            </singleparticle_processing>
        </structure_determination>
    </structure_determination_list>
    <map format="CCP4" size_kbytes="57351">
        <file>emd_52601.map.gz</file>
        <symmetry>
            <space_group>1</space_group>
        </symmetry>
        <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
        <dimensions>
            <col>621</col>
            <row>208</row>
            <sec>111</sec>
        </dimensions>
        <origin>
            <col>48</col>
            <row>257</row>
            <sec>305</sec>
        </origin>
        <spacing>
            <x>111</x>
            <y>208</y>
            <z>621</z>
        </spacing>
        <cell>
            <a units="Å">91.36743</a>
            <b units="Å">171.21104</b>
            <c units="Å">511.16373</c>
            <alpha units="deg">90.0</alpha>
            <beta units="deg">90.0</beta>
            <gamma units="deg">90.0</gamma>
        </cell>
        <axis_order>
            <fast>Z</fast>
            <medium>Y</medium>
            <slow>X</slow>
        </axis_order>
        <statistics>
            <minimum>-0.13744208</minimum>
            <maximum>0.31232294</maximum>
            <average>0.002925161</average>
            <std>0.06888288</std>
        </statistics>
        <pixel_spacing>
            <x units="Å">0.82313</x>
            <y units="Å">0.82313</y>
            <z units="Å">0.82313</z>
        </pixel_spacing>
        <contour_list>
            <contour primary="true">
                <level>0.06</level>
                <source>AUTHOR</source>
            </contour>
        </contour_list>
        <label>::::EMDATABANK.org::::EMD-52601::::</label>
        <annotation_details>Csu pilus type 1 antiparallel stack map, sharpened, pixel spacing adjusted, cropped around the model</annotation_details>
    </map>
    <interpretation>
        <modelling_list>
            <modelling>
                <initial_model>
                    <access_code>7ZL4</access_code>
                    <chain>
                        <residue_range>24-178</residue_range>
                        <source_name>PDB</source_name>
                        <initial_model_type>experimental model</initial_model_type>
                    </chain>
                    <details>The initial model consisted of a single pilus rod fragment of the same type. The initial model in turn is based on a crystal structure of CsuA/Bsc with PDB accession code 6FM5.</details>
                </initial_model>
                <refinement_protocol>RIGID BODY FIT</refinement_protocol>
                <details>UCSF Chimera was used to first fit the subunits into the single native pilus rod map (PDB Accession ID: 9I37) and average their relative angles, and it was also used to adjust pixel spacing of all maps to match model dimensions. Coot was used to adjust side chain and loop positions. A pair of antiparallel pili with subunit angles adjusted to 3-turns-per-7-subunits symmetry was overlapped with a 2D class to adjust the binding junction angle. Finally, Phenix was used to fit the type 1 stack model into the map.</details>
                <refinement_space>REAL</refinement_space>
                <overall_bvalue>668.100000000000023</overall_bvalue>
            </modelling>
        </modelling_list>
        <segmentation_list>
            <segmentation>
                <file>emd_52601_msk_1.map</file>
            </segmentation>
        </segmentation_list>
        <additional_map_list>
            <additional_map format="CCP4" size_kbytes="1492993">
                <file>emd_52601_additional_1.map.gz</file>
                <symmetry>
                    <space_group>1</space_group>
                </symmetry>
                <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
                <dimensions>
                    <col>720</col>
                    <row>720</row>
                    <sec>720</sec>
                </dimensions>
                <origin>
                    <col>0</col>
                    <row>0</row>
                    <sec>0</sec>
                </origin>
                <spacing>
                    <x>720</x>
                    <y>720</y>
                    <z>720</z>
                </spacing>
                <cell>
                    <a units="Å">592.6536</a>
                    <b units="Å">592.6536</b>
                    <c units="Å">592.6536</c>
                    <alpha units="deg">90.0</alpha>
                    <beta units="deg">90.0</beta>
                    <gamma units="deg">90.0</gamma>
                </cell>
                <axis_order>
                    <fast>X</fast>
                    <medium>Y</medium>
                    <slow>Z</slow>
                </axis_order>
                <statistics>
                    <minimum>-0.113228895</minimum>
                    <maximum>0.26640284</maximum>
                    <average>0.00005400999</average>
                    <std>0.01531014</std>
                </statistics>
                <pixel_spacing>
                    <x units="Å">0.82313</x>
                    <y units="Å">0.82313</y>
                    <z units="Å">0.82313</z>
                </pixel_spacing>
                <contour_list>
                    <contour primary="true">
                        <source>AUTHOR</source>
                    </contour>
                </contour_list>
                <label>::::EMDATABANK.org::::EMD-52601::::</label>
                <annotation_details>Csu pilus type 1 antiparallel stack map, not sharpened, pixel spacing adjusted, not cropped around the model</annotation_details>
            </additional_map>
            <additional_map format="CCP4" size_kbytes="1492993">
                <file>emd_52601_additional_2.map.gz</file>
                <symmetry>
                    <space_group>1</space_group>
                </symmetry>
                <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
                <dimensions>
                    <col>720</col>
                    <row>720</row>
                    <sec>720</sec>
                </dimensions>
                <origin>
                    <col>0</col>
                    <row>0</row>
                    <sec>0</sec>
                </origin>
                <spacing>
                    <x>720</x>
                    <y>720</y>
                    <z>720</z>
                </spacing>
                <cell>
                    <a units="Å">592.6536</a>
                    <b units="Å">592.6536</b>
                    <c units="Å">592.6536</c>
                    <alpha units="deg">90.0</alpha>
                    <beta units="deg">90.0</beta>
                    <gamma units="deg">90.0</gamma>
                </cell>
                <axis_order>
                    <fast>X</fast>
                    <medium>Y</medium>
                    <slow>Z</slow>
                </axis_order>
                <statistics>
                    <minimum>-0.13744208</minimum>
                    <maximum>0.31232294</maximum>
                    <average>0.000046508456</average>
                    <std>0.016765174</std>
                </statistics>
                <pixel_spacing>
                    <x units="Å">0.82313</x>
                    <y units="Å">0.82313</y>
                    <z units="Å">0.82313</z>
                </pixel_spacing>
                <contour_list>
                    <contour primary="true">
                        <source>AUTHOR</source>
                    </contour>
                </contour_list>
                <label>::::EMDATABANK.org::::EMD-52601::::</label>
                <annotation_details>Csu pilus type 1 antiparallel stack map, sharpened, pixel spacing adjusted, not cropped around the model</annotation_details>
            </additional_map>
        </additional_map_list>
        <half_map_list>
            <half_map format="CCP4" size_kbytes="1492993">
                <file>emd_52601_half_map_1.map.gz</file>
                <symmetry>
                    <space_group>1</space_group>
                </symmetry>
                <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
                <dimensions>
                    <col>720</col>
                    <row>720</row>
                    <sec>720</sec>
                </dimensions>
                <origin>
                    <col>0</col>
                    <row>0</row>
                    <sec>0</sec>
                </origin>
                <spacing>
                    <x>720</x>
                    <y>720</y>
                    <z>720</z>
                </spacing>
                <cell>
                    <a units="Å">592.6536</a>
                    <b units="Å">592.6536</b>
                    <c units="Å">592.6536</c>
                    <alpha units="deg">90.0</alpha>
                    <beta units="deg">90.0</beta>
                    <gamma units="deg">90.0</gamma>
                </cell>
                <axis_order>
                    <fast>X</fast>
                    <medium>Y</medium>
                    <slow>Z</slow>
                </axis_order>
                <statistics>
                    <minimum>-1.3587024</minimum>
                    <maximum>1.4169768</maximum>
                    <average>0.00007307767</average>
                    <std>0.18081288</std>
                </statistics>
                <pixel_spacing>
                    <x units="Å">0.82313</x>
                    <y units="Å">0.82313</y>
                    <z units="Å">0.82313</z>
                </pixel_spacing>
                <contour_list>
                    <contour primary="true">
                        <source>AUTHOR</source>
                    </contour>
                </contour_list>
                <label>::::EMDATABANK.org::::EMD-52601::::</label>
                <annotation_details>Csu pilus type 1 antiparallel stack map, half map A, pixel spacing adjusted</annotation_details>
            </half_map>
            <half_map format="CCP4" size_kbytes="1492993">
                <file>emd_52601_half_map_2.map.gz</file>
                <symmetry>
                    <space_group>1</space_group>
                </symmetry>
                <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
                <dimensions>
                    <col>720</col>
                    <row>720</row>
                    <sec>720</sec>
                </dimensions>
                <origin>
                    <col>0</col>
                    <row>0</row>
                    <sec>0</sec>
                </origin>
                <spacing>
                    <x>720</x>
                    <y>720</y>
                    <z>720</z>
                </spacing>
                <cell>
                    <a units="Å">592.6536</a>
                    <b units="Å">592.6536</b>
                    <c units="Å">592.6536</c>
                    <alpha units="deg">90.0</alpha>
                    <beta units="deg">90.0</beta>
                    <gamma units="deg">90.0</gamma>
                </cell>
                <axis_order>
                    <fast>X</fast>
                    <medium>Y</medium>
                    <slow>Z</slow>
                </axis_order>
                <statistics>
                    <minimum>-1.3888241</minimum>
                    <maximum>1.2992612</maximum>
                    <average>0.000065970766</average>
                    <std>0.17232701</std>
                </statistics>
                <pixel_spacing>
                    <x units="Å">0.82313</x>
                    <y units="Å">0.82313</y>
                    <z units="Å">0.82313</z>
                </pixel_spacing>
                <contour_list>
                    <contour primary="true">
                        <source>AUTHOR</source>
                    </contour>
                </contour_list>
                <label>::::EMDATABANK.org::::EMD-52601::::</label>
                <annotation_details>Csu pilus type 1 antiparallel stack map, half map B, pixel spacing adjusted</annotation_details>
            </half_map>
        </half_map_list>
    </interpretation>
</emd>
