2026-03-18 REL PDBe INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY DATABASE_REFERENCES citation em_admin _citation.pdbx_database_id_PubMed _citation.title _em_admin.last_update EXPERIMENTAL_SUMMARY citation em_admin _citation.pdbx_database_id_PubMed _citation.title _em_admin.last_update DATABASE_REFERENCES citation em_admin _citation.journal_volume _em_admin.last_update EXPERIMENTAL_SUMMARY citation em_admin _citation.journal_volume _em_admin.last_update PDBe PDBe 2025-05-07 2026-02-04 2026-02-04 2026-03-18 Spanish Ministry of Science, Innovation, and Universities PID2021-124602OB-I00 Spain Instruct-ERIC Center (Strasbourg Centre) France CryoEM structure of MraZ in complex with its promoter from Mycoplasma genitalium Reverter D Sanchez-Alba L Durand A MraZ, transcription factor, DNA BINDING PROTEIN Sanchez-Alba L Varejao N Durand A Garcia-Pardo J Carreras-Caballe M Amador V Pinyol J Reverter D Structural basis for transcriptional regulation by the cell division regulator MraZ in Mycoplasma genitalium. Nat Commun UK 17 2026 41611686 doi:10.1038/s41467-026-68809-2 2041-1723 9r4j FULLOVERLAP EMDB EMD-53569 associated EM volume
CryoEM structure of MraZ in complex with its promoter from Mycoplasma genitalium
 Complex between four MraZ subunits and the promoter region from Mycoplasma genitalium Complex between four MraZ subunits and the promoter region from Mycoplasma genitalium 0 1 2 3 Mycoplasmoides genitalium G37 Transcriptional regulator MraZ Mycoplasmoides genitalium 0.01849691 4 Escherichia coli LEVO MGSSHHHHHHSSGLVPRGSHMLLGTFNLTLDNKNRISLPAKLRSFFDSSIVINRGFENCLEIRKPADFESYFQTFNNFPN TQKDTRTLKRLIFANANLVELDSANRILIPNNLISDAKLDKEIVLIGQFDHLEVWDKVQYEQYLASSESLETVAERMKDA K P47463 DNA (33-MER) Mycoplasmoides genitalium 0.01029067 1 (DT)(DT)(DT)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DC)(DG)(DC)(DA)(DA)(DA)(DG)(DT)(DG) (DT)(DG)(DA)(DC)(DA)(DA)(DA)(DG)(DT)(DG)(DG)(DA)(DA) DNA DNA (35-MER) Mycoplasmoides genitalium 0.010607845 1 (DT)(DT)(DC)(DC)(DA)(DC)(DT)(DT)(DT)(DG)(DT)(DC)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DG) (DC)(DG)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)(DA)(DA)(DA)(DC)(DA) DNA singleParticle particle 0.7 8.0 250.0 NaCl Sodium chloride 20.0 Tris Tris 1.0 EDTA EDTA UltrAuFoil R1.2/1.3 GOLD 300 PLASMA CLEANING OTHER ETHANE 100 279 FEI VITROBOT MARK IV TFS KRIOS FLOOD BEAM BRIGHT FIELD FIELD EMISSION GUN 300 0.8 2.2 165000.0 TFS Selectris X 10 FEI FALCON IV (4k x 4k) 1 9195 3.0 44.48 1 CTFFIND PHASE FLIPPING AND AMPLITUDE CORRECTION 9QLG 3.36 FSC 0.143 CUT-OFF RELION EMReady 928675 MAXIMUM LIKELIHOOD MAXIMUM LIKELIHOOD emd_53569.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 360 360 360 0 0 0 360 360 360 262.44 262.44 262.44 90.0 90.0 90.0 X Y Z -0.0074013406 0.010031527 -0.000006657068 0.00039225505 0.72900003 0.72900003 0.72900003 0.000561 AUTHOR Full map emd_53569_half_map_1.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 360 360 360 0 0 0 360 360 360 262.44 262.44 262.44 90.0 90.0 90.0 X Y Z -0.007346894 0.011196015 -0.0000065980225 0.0004662217 0.72900003 0.72900003 0.72900003 AUTHOR half map 1 emd_53569_half_map_2.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 360 360 360 0 0 0 360 360 360 262.44 262.44 262.44 90.0 90.0 90.0 X Y Z -0.0093273055 0.011769797 -0.0000069347666 0.0004664004 0.72900003 0.72900003 0.72900003 AUTHOR half map 2