2026-03-04 REL PDBe INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY PDBe PDBe 2026-01-22 2026-03-04 2026-03-04 2026-03-04 Knut and Alice Wallenberg Foundation 2022.0241 Sweden Novo Nordisk Foundation NNF18OC0032828 Denmark Swedish Research Council 2025-03943 Sweden Escherichia coli ribosome arrested on a chimeric, 130-residue construct featuring a firefly-luciferase truncation followed by SecM(3W) Westerfield JM von Heijne G Firefly luciferase, cotranslational folding, Rossmann fold, multi-domain protein, Ribosome-nascent chain, RIBOSOME Mitsikosta S Westerfield JM Pardo-Avila F Levitt M von Heijne G Metola A Quasi-continuous cotranslational compaction and folding of a multidomain protein. Biorxiv US 2026 41676707 doi:10.64898/2026.02.04.703729 2692-8205 EMDB EMD-56453 associated EM volume Escherichia coli ribosome arrested on chimaeric nascent chain composed of truncated firefly luciferase and the SecM(3W) arrest peptide, N=130 Escherichia coli ribosome arrested on chimaeric nascent chain composed of truncated firefly luciferase and the SecM(3W) arrest peptide, N=130 0 1 Escherichia coli BL21(DE3) FLuc SecM(3W) N = 130 Escherichia coli BL21(DE3) Escherichia coli BL21(DE3) LEVO MHHHHHHEDAKNIKKGPAPFYPLEDGTAGEQLHKAMKRYALVPGTIAFTDAHIEVDITYAEYFEMSVRLAEAMKRYGLNTNHRIVVCSENSLQFFMPVLGALFIGVAVAPANDIYNSGSFSTPVWIWWWPPIRGSPGSSDKQEGEWPTGLRLSRIGGIH singleParticle particle 7.5 50.0 HEPES-KOH, pH 7.5 150.0 KOAc 10.0 Mg(OAc)2 750.0 Sucrose 1.0 DDM Quantifoil R3.5/1 COPPER 200 CARBON HOLEY GLOW DISCHARGE AIR
The grid was ultrathin carbon coated by flotation.
 ETHANE 100 277.15 FEI VITROBOT MARK IV TFS KRIOS FLOOD BEAM BRIGHT FIELD FIELD EMISSION GUN 300 50.0 1.67 0.6 2.4 105000.0 FEI TITAN KRIOS AUTOGRID HOLDER NITROGEN FEI FALCON IV (4k x 4k) 1 8723 1.74 40.0 1 cryoSPARC 4.3.0 PHASE FLIPPING AND AMPLITUDE CORRECTION 2.29 FSC 0.143 CUT-OFF cryoSPARC 4.3.0 770654 MAXIMUM LIKELIHOOD cryoSPARC 4.3.0 MAXIMUM LIKELIHOOD cryoSPARC 4.3.0 4 cryoSPARC 4.3.0 emd_56453.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 550 550 550 0 0 0 550 550 550 455.4 455.4 455.4 90.0 90.0 90.0 X Y Z -0.4000936 1.0048639 -0.0009933535 0.03059871 0.828 0.828 0.828 0.1 AUTHOR Main map emd_56453_half_map_1.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 550 550 550 0 0 0 550 550 550 455.4 455.4 455.4 90.0 90.0 90.0 X Y Z -0.6431376 1.2162664 0.0010585721 0.078210846 0.828 0.828 0.828 AUTHOR Half map A emd_56453_half_map_2.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 550 550 550 0 0 0 550 550 550 455.4 455.4 455.4 90.0 90.0 90.0 X Y Z -0.6325231 1.1869763 0.0010641634 0.07795403 0.828 0.828 0.828 AUTHOR Half map B