Sub-particle structure of the iterative acetyltransferase from Actinomycetes in complex with AcCoA and monoacetylated lasso peptides

2026-04-01 REL PDBc INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY DATABASE_REFERENCES citation citation_author em_admin _citation.country _citation.journal_abbrev _citation.journal_id_CSD _citation.journal_id_ISSN _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.title _citation.year _em_admin.last_update EXPERIMENTAL_SUMMARY citation citation_author em_admin _citation.country _citation.journal_abbrev _citation.journal_id_CSD _citation.journal_id_ISSN _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.title _citation.year _em_admin.last_update PDBj PDBc 2025-04-02 2026-02-25 2026-02-25 2026-04-01 National Natural Science Foundation of China (NSFC) 22077056 China National Natural Science Foundation of China (NSFC) 22377046 China National Natural Science Foundation of China (NSFC) 32171300 China National Natural Science Foundation of China (NSFC) 2210070084 China National Natural Science Foundation of China (NSFC) 21907046 China Other government 22ZD6FA006 Other government 23ZDFA015 Sub-particle structure of the iterative acetyltransferase from Actinomycetes in complex with AcCoA and monoacetylated lasso peptides Wu S Xiong J Lei D Dong S GCN5-related N-acetyltransferases, Actinomycetes, AcCoA, Lasso peptides, TRANSFERASE Xiong J Wu S Liang ZQ Fang S Tao FY Gong XT Wu X Wu Q Cui JJ Gao K Hoi KK Peng Y Luo S Lei D Dong SH Iterative acylation on mature lasso peptides by widespread acetyltransferases. Nat.Chem.Biol. US 2026 41826761 doi:10.1038/s41589-026-02149-6 1552-4469 9ubc FULLOVERLAP PDB 9IY3 unspecified PDB 9IY4 unspecified EMDB EMD-64004 associated EM volume

Complex of iterative acetyltransferase, AcCoA and monoacetylated lasso peptides Complex of iterative acetyltransferase, AcCoA and monoacetylated lasso peptides 0 1 2 Actinosynnema mirum DSM 43827 Iterative acetyltransferase 1 1 monoacetylated lasso peptides 1 2 GCN5-related N-acetyltransferase Actinosynnema mirum DSM 43827 0.021676164 1 Escherichia coli LEVO MSPQDDLIVWLRGDRAGLGPFSADLVDQYWRWEQDPSVLIGYGRQTPDSLENRREGYGHQARGTDDQLRFTVYDLTGQDP VPVGTTAVLIDHHVRTGEFVIQLGAGHRGRGLGTEATRLTLDYAFHVSALACVHLAVLTPNTGAIAAYERAGFRRIGERR DSGFWLGRRVSETLMDAVPEDFPGPSVVRGFVEGGR C6WJ45 Albusnodin family lasso peptide Actinosynnema mirum DSM 43827 0.001681787 1 Escherichia coli LEVO GQGKGSAED(ALY)RRAYN A0A7W7W6P0 ACETYL COENZYME *A 0.000809571 1 ACO singleParticle particle 7.5 ETHANE TFS KRIOS FLOOD BEAM BRIGHT FIELD FIELD EMISSION GUN 300 0.8 2.0 GATAN K3 (6k x 4k) 60.0 1 PHASE FLIPPING AND AMPLITUDE CORRECTION 3.43 FSC 0.143 CUT-OFF 78368 MAXIMUM LIKELIHOOD MAXIMUM LIKELIHOOD emd_64004.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 128 128 128 0 0 0 128 128 128 106.368 106.368 106.368 90.0 90.0 90.0 X Y Z -0.34032515 15.41868 0.20299736 1.0853145 0.831 0.831 0.831 1.4 AUTHOR ::::EMDATABANK.org::::EMD-64004:::: emd_64004_msk_1.map emd_64004_additional_1.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 256 256 256 -64 -64 -64 256 256 256 212.736 212.736 212.736 90.0 90.0 90.0 X Y Z -0.0033420802 0.081242844 0.0002987465 0.0036377767 0.831 0.831 0.831 AUTHOR ::::EMDATABANK.org::::EMD-64004:::: Sharpened density map of the whole particle reconstructed with D7 symmetry averaging. emd_64004_additional_2.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 256 256 256 -64 -64 -64 256 256 256 212.736 212.736 212.736 90.0 90.0 90.0 X Y Z -0.010725565 0.03909243 0.00020862205 0.0022780714 0.831 0.831 0.831 AUTHOR ::::EMDATABANK.org::::EMD-64004:::: Unsharpened density map of the whole particle reconstructed with D7 symmetry averaging. emd_64004_half_map_2.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 128 128 128 0 0 0 128 128 128 106.368 106.368 106.368 90.0 90.0 90.0 X Y Z -0.5194019 0.70790756 0.007492671 0.08603923 0.831 0.831 0.831 AUTHOR ::::EMDATABANK.org::::EMD-64004:::: emd_64004_half_map_1.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 128 128 128 0 0 0 128 128 128 106.368 106.368 106.368 90.0 90.0 90.0 X Y Z -0.46855816 0.6811191 0.007473838 0.08599758 0.831 0.831 0.831 AUTHOR ::::EMDATABANK.org::::EMD-64004::::