2025-11-26 REL RCSB INITIAL_RELEASE REPOSITORY RCSB RCSB 2025-08-15 2025-11-26 2025-11-26 2025-11-26 Canadian Institutes of Health Research (CIHR) Canada Nucleotide-free structure of PmtCD in peptidisc Worrall LJ Li FKK Hu J Lazarski AC Strynadka NCJ ABC transporter, MEMBRANE PROTEIN Hu J Lazarski AC Li FKK Worrall LJ Burgin DJ Zeytuni N Dickey SW Otto M Strynadka NCJ Cryo-EM analysis of the Staphylococcus aureus phenol-soluble modulin exporter PmtCD apo form in detergent micelles, nanodiscs and peptidiscs. Commun Biol UK 8 1576 1576 2025 41249510 doi:10.1038/s42003-025-08955-3 2399-3642 EMD-72145 other EM volume
Nucleotide-free structure of PmtCD in detergent LMNG
 EMD-72169 other EM volume
Nucleotide-free structure of PmtCD in nanodisc
 EMD-72173 other EM volume
ADP-bound structure of PmtCD in peptidisc
 9q2q FULLOVERLAP EMDB EMD-72145 other EM volume
Nucleotide-free structure of PmtCD in detergent LMNG
 EMDB EMD-72169 other EM volume
Nucleotide-free structure of PmtCD in nanodisc
 EMDB EMD-72173 other EM volume
ADP-bound structure of PmtCD in peptidisc
 EMDB EMD-72172 associated EM volume
Nucleotide-free structure of PmtCD in peptidisc
 Hetero tetrameric complex of PmtC (2) and PmtD (2) Hetero tetrameric complex of PmtC (2) and PmtD (2) 0 1 2 Staphylococcus aureus Phenol-soluble modulin export ABC transporter permease subunit PmtD Staphylococcus aureus 0.028435116999999996 2 Staphylococcus aureus LEVO RGSHRILNLVKYDLYSIFKSPLTYLAILVVSSLIATQSILMANSMDNPKHIIVYGSVFAAAKWLLLIIGLMFVVKTITRD FSQGTIQLYMSKVKTRVGYIISKTISIILISILFALIHYVILIVVQASSNGKNLAFSKYVDNLWFFLIFLLFFGLFLFLI TLASQKTAMIFSLGVFLVLIVPFIKPFITFIPRYGEKVLDAFDYIPFAYLTDKMISSNFDFSNWQWVISLGSIVIFFILN ILYVAKKDI A0A641A693 ABC transporter ATP-binding protein Staphylococcus aureus 0.033001098 2 Staphylococcus aureus LEVO MKLEHITKKYGSNVVLNDIDFDFGDSRIVGLIGKNGVGKTTVMKVMNGNIIKFDGKVDIDNADNIGFLIEHPKLYDNKSG LYNLKLFAQVLGKGFDKAYTDKIIDAFGMRPYIKKKVKKYSMGMKQKLAIAVSLMNKPKFLILDEPTNGMDPDGSIDVLT TIKSLVNELDMRILISSHKLEDIELICDRAVFLRDGHFVQDVNMEEGVASDTTIVTVDHKDFDRTEKYLAEHFQLQNVDK ADGHLMINAQKNYQVILKALSELDIYPKYIETRKSSLRDTYFNINQRGDK X5EJW5 singleParticle particle 8.800000000000001 ETHANE TFS KRIOS FLOOD BEAM BRIGHT FIELD FIELD EMISSION GUN 300 1.5 3.5 GATAN K3 BIOQUANTUM (6k x 4k) 50.0 1 PHASE FLIPPING AND AMPLITUDE CORRECTION 6XJI 4.3 FSC 0.143 CUT-OFF cryoSPARC 3.2 108661 MAXIMUM LIKELIHOOD MAXIMUM LIKELIHOOD emd_72172.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 170 170 170 0 0 0 170 170 170 229.5 229.5 229.5 90.0 90.0 90.0 X Y Z -0.10715694 0.16723713 0.00033326197 0.0050474135 1.35 1.35 1.35 0.03 AUTHOR Flipped map for model building/fitting emd_72172_half_map_1.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 170 170 170 0 0 0 170 170 170 229.5 229.5 229.5 90.0 90.0 90.0 X Y Z -0.034670062 0.077499725 -0.00019203035 0.0040037497 1.35 1.35 1.35 AUTHOR emd_72172_half_map_2.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 170 170 170 0 0 0 170 170 170 229.5 229.5 229.5 90.0 90.0 90.0 X Y Z -0.038478483 0.079534575 -0.00019045515 0.003983117 1.35 1.35 1.35 AUTHOR