2026-03-11 REL RCSB INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY RCSB RCSB 2026-01-21 2026-03-11 2026-03-11 2026-03-11 National Institutes of Health/National Institute on Aging (NIH/NIA) P01AG002132 United States National Institutes of Health/National Institute on Aging (NIH/NIA) P30AG062422 United States National Institutes of Health/National Institute on Aging (NIH/NIA) P01AG019724 United States National Institutes of Health/National Institute on Aging (NIH/NIA) U01AG057195 United States National Institutes of Health/National Institute on Aging (NIH/NIA) U19AG063911 United States Other private Other private National Institutes of Health/National Institute on Aging (NIH/NIA) U19: AG063911 United States Other private U54 NS092089 Other private U01 AG045390 National Institutes of Health/National Institute on Aging (NIH/NIA) P01 AG019724 United States Other private P30 AG062422 National Institutes of Health/National Institute on Aging (NIH/NIA) U24 AG21886 United States Other private A141860 S305I Frontotemporal Lobar Degeneration (FTLD) type II tau filament Pan HS Merz GE Tse E Southworth DR tau, MAPT, FTD, FTLD, amyloid, neurodegeneration, PROTEIN FIBRIL Pan HS Merz GE Li AN Le MQ Jo H Quddus A Yung A Kormos RC Melo AA Ramos EM Lago AL Spina S Grinberg LT Rosen HJ Tse E Gorno-Tempini ML DeGrado WF Seeley WW Southworth DR Distinct tau filament folds in familial frontotemporal dementia due to the MAPT S305I mutation. Biorxiv US 2026 41726928 doi:10.64898/2026.02.12.705620 2692-8205 10ik FULLOVERLAP EMDB EMD-75196 associated EM volume
S305I Frontotemporal Lobar Degeneration (FTLD) type II tau filament
 Filaments purified S305I FTLD individual brain tissue Filaments purified S305I FTLD individual brain tissue 0 1 Homo sapiens Microtubule-associated protein tau Homo sapiens 0.011562394 10 Escherichia coli LEVO GKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGIVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQS KIGSLDNITHVPGGGNKKIETHKLTFR P10636 helical tissue 7.4 Quantifoil R1.2/1.3 GOLD 200 CARBON HOLEY 12.0 ETHANE TFS KRIOS FLOOD BEAM BRIGHT FIELD FIELD EMISSION GUN 300 70.0 0.8 1.8 105000.0 FEI TITAN KRIOS AUTOGRID HOLDER NITROGEN GATAN K3 (6k x 4k) 1 7393 5.4 46.0 1 4.83 178.8 C1 3.2 FSC 0.143 CUT-OFF RELION 5.0.0 42794 PHASE FLIPPING AND AMPLITUDE CORRECTION NOT APPLICABLE emd_75196.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 300 300 300 0 0 0 300 300 300 250.2 250.2 250.2 90.0 90.0 90.0 X Y Z -0.03273003 0.05386381 0.00005883607 0.0012101403 0.834 0.834 0.834 0.00836 AUTHOR S305I Type II Fold Map emd_75196_msk_1.map emd_75196_half_map_1.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 300 300 300 0 0 0 300 300 300 250.2 250.2 250.2 90.0 90.0 90.0 X Y Z -0.026198829 0.03732929 0.0012913691 0.002767464 0.834 0.834 0.834 AUTHOR S305I Type II Fold Half-map 1 from the 3D Refinement emd_75196_half_map_2.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 300 300 300 0 0 0 300 300 300 250.2 250.2 250.2 90.0 90.0 90.0 X Y Z -0.02414522 0.038307786 0.0013213118 0.0027838824 0.834 0.834 0.834 AUTHOR S305I Type II Fold Half-map 2 from the 3D Refinement